Structure of PDB 8j91 Chain F

Receptor sequence
>8j91F (length=78) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
NIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTE
HARRKTVTAMDVVYALKRQGRTLYGFGG
3D structure
PDB8j91 Molecular and structural basis of the chromatin remodeling activity by Arabidopsis DDM1.
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R45 I46 G48 K79 T80 R21 I22 G24 K55 T56
BS02 dna F T30 P32 R36 R45 T6 P8 R12 R21
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0009414 response to water deprivation
Cellular Component
GO:0000325 plant-type vacuole
GO:0000786 nucleosome
GO:0005576 extracellular region
GO:0005634 nucleus
GO:0005694 chromosome
GO:0005730 nucleolus
GO:0005777 peroxisome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0009506 plasmodesma
GO:0009507 chloroplast
GO:0009536 plastid
GO:0009579 thylakoid

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8j91, PDBe:8j91, PDBj:8j91
PDBsum8j91
PubMed38992002
UniProtP59259|H4_ARATH Histone H4 (Gene Name=At1g07660)

[Back to BioLiP]