Structure of PDB 8ir8 Chain F

Receptor sequence

>8ir8F (length=34) Species: 32053 (Thermostichus vulcanus)

SYPIFTVRWVAVHTLAVPTIFFLGAIAAMQFIQR

3D structure

• PDB: 8ir8 Oxygen-evolving photosystem II structures during S1-S2-S3 transitions.
• Chain: F
• Resolution: 2.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	F	R19 W20 V23 H24 A27	R8 W9 V12 H13 A16

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009767 photosynthetic electron transport chain
• GO:0015979 photosynthesis
• GO:0019684 photosynthesis, light reaction

Cellular Component

• GO:0005737 cytoplasm
• GO:0009523 photosystem II
• GO:0009539 photosystem II reaction center
• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:8ir8, PDBe:8ir8, PDBj:8ir8
• PDBsum: 8ir8
• PubMed: 38297122
• UniProt: P12239|PSBF_THEVL Cytochrome b559 subunit beta (Gene Name=psbF)