Structure of PDB 8i24 Chain F

Receptor sequence

>8i24F (length=233) Species: 637887 (Acetivibrio thermocellus DSM 1313)

EHTKRIIIEYLNRIKAGDDSAREEFILRFRPFILKLVYKATDRHVEPENS
EEYSVALLAFNEAINAYDEEKHSNFLVFSEQVINRRLIDYKRKNHKNKMV
YPFSYFENEDIKLERTLSDADGNNAIERLEFTDEIRLFKSELASFDITFK
DLLSSTPKHRDSRELLINIAKKIASNDGLYEKLKKTKKLPTLELLKLAKV
SRRTIERNKKYIIAVSLILRSNLEIFKEYAAGI

3D structure

• PDB: 8i24 Structure of the transcription open complex of distinct sigmaI factors
• Chain: F
• Resolution: 3.36 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	T15 K16 R40 F41 P43 F44 L46 K47 Y50 H56 V57 E74 K83 H84 S85 N86 L88 F90 Q93 R97 R98 D101 H171 R172 D173 L204 R214 R215 E218	T3 K4 R28 F29 P31 F32 L34 K35 Y38 H44 V45 E62 K71 H72 S73 N74 L76 F78 Q81 R85 R86 D89 H159 R160 D161 L192 R202 R203 E206
BS02	dna	F	R97 D101 R104 H107 P169 K170 S213	R85 D89 R92 H95 P157 K158 S201

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8i24, PDBe:8i24, PDBj:8i24
• PDBsum: 8i24
• PubMed: 37833284
• UniProt: A3DH98|SIGI6_ACET2 RNA polymerase sigma factor SigI6 (Gene Name=sigI6)