Structure of PDB 8i23 Chain F

Receptor sequence

>8i23F (length=230) Species: 637887 (Acetivibrio thermocellus DSM 1313) [Search protein sequence]

IVYDDFISTLRQIKEGNHQLREEFISEYKPFILKVTSNATGKYIDTRNSD
EFSIALSAFNEAIDKFDIEKGYNFFLFSEQVIRRRLIDYSRSNKDDKEYP
FSFFDDEYFYNNEKLLSKSYIGFEDIEAREDIEELKKKLQEFGITFLDLV
LNVPKHRDSRQLCIRLAKMLAEDEQMYNALMKNKNIPRNELKKKAKVHGR
TIGNNRKYIIALCLIFRSNLNLSKRYLEYY

3D structure

PDB

8i23 Structure of the transcription open complex of distinct sigmaI factors

Chain

Resolution

3.03 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	Y20 E44 Y45 P47 K51 S54 Y60 I61 K82 F83 K87 G88 N90 F92 F94 Q97 V98 R101 R102 D105 H173 R174 D175 N202 R205 N206 R217 R223	Y3 E27 Y28 P30 K34 S37 Y43 I44 K65 F66 K70 G71 N73 F75 F77 Q80 V81 R84 R85 D88 H156 R157 D158 N185 R188 N189 R200 R206
BS02	dna	F	R101 I104 R108 F120 F121 Y125 K172 H173 S176 K213 V214 H215 R217 T218	R84 I87 R91 F103 F104 Y108 K155 H156 S159 K196 V197 H198 R200 T201

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity
GO:0016987	sigma factor activity

	Biological Process
GO:0006352	DNA-templated transcription initiation
GO:0006355	regulation of DNA-templated transcription
GO:0010468	regulation of gene expression
GO:2000142	regulation of DNA-templated transcription initiation

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8i23, PDBe:8i23, PDBj:8i23
PDBsum	8i23
PubMed	37833284
UniProt	A3DBH0\|SIGI1_ACET2 RNA polymerase sigma factor SigI1 (Gene Name=sigI1)

[Back to BioLiP]