Structure of PDB 8h8s Chain F |
>8h8sF (length=91) Species: 9913 (Bos taurus) [Search protein sequence] |
GGGVPTDEEQATGLEREVMLAARKGQDPYNILAPKATSGTKEDPNLVPSI TNKRIVGCICEEDNSTVIWFWLHKGEAQRCPSCGTHYKLVP |
|
PDB | 8h8s Calcium-bound structure of bovine cytochrome c oxidase. |
Chain | F |
Resolution | 1.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
ZN |
F |
C60 C62 C82 C85 |
C58 C60 C80 C83 |
|
|
|
|