Structure of PDB 8gzh Chain F

Receptor sequence

>8gzhF (length=314) Species: 1148 (Synechocystis sp. PCC 6803)

PYTEDSIRIYLQEIGRIRLLRAEEEIELARQIADLLELELIRDNLTLQLE
RQPSELEWGKQNKNFAAFRRRLFLDRRAKDKMVQSNLRLVVSIAKKYMNR
GLSFQDLIQEGSLGLIRAAEKFDHEKGYKFSTYATWWIRQAITRAIADQS
RTIRLPVHLYETISRIKKTTKLLSQEMRRKPTEEEIAEKMEMTIEKLRFI
AKSAQLPISLETPIGKEEDSRLGDFIEADGETPEDEVSKNLLREDLENVL
DTLSPRERDVLRLRYGLDDGRMKTLEEIGQIFNVTRERIRQIEAKALRKL
RHPNRNSILKEYIR

3D structure

• PDB: 8gzh Cryo-EM structure of Synechocystis sp. PCC 6803 CTP-bound RPitc
• Chain: F
• Resolution: 2.96 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	D71 R74 G81 L85 N197 R199 L200 S203 K206 R228 F233 D234 K237 Y239 K240 S242 T243 Y244 T246 W247 Q251 R255 R265 H269 R367 V395 T396 E398	D5 R8 G15 L19 N86 R88 L89 S92 K95 R117 F122 D123 K126 Y128 K129 S131 T132 Y133 T135 W136 Q140 R144 R154 H158 R256 V284 T285 E287
BS02	dna	F	R211 S275 K279 I319 I325 F336 L386 R401	R100 S164 K168 I208 I214 F225 L275 R290

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:8gzh, PDBe:8gzh, PDBj:8gzh
• PDBsum: 8gzh
• UniProt: P74565|SIGA_SYNY3 RNA polymerase sigma factor SigA (Gene Name=sigA)