Structure of PDB 8gxc Chain F |
>8gxcF (length=92) Species: 9606 (Homo sapiens) [Search protein sequence] |
RPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAF VIFKEVSSATNALRSMQGFPFYDKPMRIQYAKTDSDIIAKMK |
|
PDB | 8gxc Structure-based investigations of the NAD+-II riboswitch. |
Chain | F |
Resolution | 2.5 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
F |
R46 S47 L48 |
R41 S42 L43 |
|
|
|
|