Structure of PDB 8ghm Chain F

Receptor sequence

>8ghmF (length=43) Species: 4932 (Saccharomyces cerevisiae)

ILIDVPLYQADTNDYLDENGQVIFNLSTLIKEKYHKDGFFVYF

3D structure

• PDB: 8ghm Structure of the Hir histone chaperone complex.
• Chain: F
• Resolution: 12.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	F	V596 Y597 F598	V41 Y42 F43

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0005515 protein binding
• GO:0031491 nucleosome binding

Biological Process

• GO:0000082 G1/S transition of mitotic cell cycle
• GO:0006325 chromatin organization
• GO:0006334 nucleosome assembly
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0006368 transcription elongation by RNA polymerase II
• GO:1905268 negative regulation of chromatin organization

Cellular Component

• GO:0000417 HIR complex
• GO:0005634 nucleus
• GO:0005694 chromosome

External links

• PDB: RCSB:8ghm, PDBe:8ghm, PDBj:8ghm
• PDBsum: 8ghm
• PubMed: 38925115
• UniProt: Q01448|HPC2_YEAST Histone promoter control protein 2 (Gene Name=HPC2)