Structure of PDB 8euy Chain F

Receptor sequence

>8euyF (length=240) Species: 4896 (Schizosaccharomyces pombe)

ASIFAPESLLKKTKAQKQSREQIVAAAAEKKSARQKKRELIAKRAEAYEA
EYRAAEREQIELARKARAEGNYFVPHEPKLIFVVRIRGINNIPPKARKIM
QLLRLLQINNGIFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRELIYKRGF
GKVNKQRIPLSDNAIIEAALGKYSILSVEDLIHEIYTVGPNFKQAANFLW
PFKLSSPLGGWRERKFKHFIEGGDAGKRDEHINGLVQKML

3D structure

• PDB: 8euy Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: F
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K22 R44 R48 R67 I70 R74 R77 R97 G98 I99 N100 P104 K105 K108 I109 L112 R114 Q117 N119 K128 E132 N147 K149 R152 K157 R158 Q166 R167 K203 N207 K213 L214 S215 S216 P217 L218 G219 G220 W221 E223 R224 K225 F226	K12 R34 R38 R57 I60 R64 R67 R87 G88 I89 N90 P94 K95 K98 I99 L102 R104 Q107 N109 K118 E122 N137 K139 R142 K147 R148 Q156 R157 K193 N197 K203 L204 S205 S206 P207 L208 G209 G210 W211 E213 R214 K215 F216
BS02	peptide	F	K75 G80 N81 Y82 F83 V84	K65 G70 N71 Y72 F73 V74

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8euy, PDBe:8euy, PDBj:8euy
• PDBsum: 8euy
• PubMed: 36423630
• UniProt: P25457|RL7B_SCHPO Large ribosomal subunit protein uL30B (Gene Name=rpl702)