Structure of PDB 8eth Chain F

Receptor sequence

>8ethF (length=239) Species: 4896 (Schizosaccharomyces pombe)

SIFAPESLLKKTKAQKQSREQIVAAAAEKKSARQKKRELIAKRAEAYEAE
YRAAEREQIELARKARAEGNYFVPHEPKLIFVVRIRGINNIPPKARKIMQ
LLRLLQINNGIFVKFNKAIKEMLQVVEPYVTYGIPNHKTVRELIYKRGFG
KVNKQRIPLSDNAIIEAALGKYSILSVEDLIHEIYTVGPNFKQAANFLWP
FKLSSPLGGWRERKFKHFIEGGDAGKRDEHINGLVQKML

3D structure

• PDB: 8eth Chromatin localization of nucleophosmin organizes ribosome biogenesis.
• Chain: F
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	S18 K22 A25 Q26 R44 R67 I70 R74 R77 R97 G98 I99 N100 P104 K105 K108 I109 L112 R114 Q117 I118 N119 A129 M133 N147 K149 R152 K157 R158 Q166 R167 K203 N207 K213 L214 S215 S216 P217 L218 G219 G220 W221 E223 R224 K225 F226	S7 K11 A14 Q15 R33 R56 I59 R63 R66 R86 G87 I88 N89 P93 K94 K97 I98 L101 R103 Q106 I107 N108 A118 M122 N136 K138 R141 K146 R147 Q155 R156 K192 N196 K202 L203 S204 S205 P206 L207 G208 G209 W210 E212 R213 K214 F215
BS02	peptide	F	N81 Y82 F83 V84 H86	N70 Y71 F72 V73 H75

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0002181 cytoplasmic translation

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8eth, PDBe:8eth, PDBj:8eth
• PDBsum: 8eth
• PubMed: 36423630
• UniProt: P25457|RL7B_SCHPO Large ribosomal subunit protein uL30B (Gene Name=rpl702)