Structure of PDB 8eng Chain F

Receptor sequence
>8engF (length=93) Species: 9606 (Homo sapiens) [Search protein sequence]
KIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALAHRWGIQKG
NRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGG
3D structure
PDB8eng DNA selection by the master transcription factor PU.1.
ChainF
Resolution1.25 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F S203 K206 R230 R233 K243 K247 L248 S35 K38 R62 R65 K75 K79 L80
BS02 dna F R171 W213 K217 N219 K221 M223 K227 Y235 R3 W45 K49 N51 K53 M55 K59 Y67
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8eng, PDBe:8eng, PDBj:8eng
PDBsum8eng
PubMed37352101
UniProtP17947|SPI1_HUMAN Transcription factor PU.1 (Gene Name=SPI1)

[Back to BioLiP]