Structure of PDB 8el5 Chain F

Receptor sequence

>8el5F (length=173) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

FSKVITSADGKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASCIVSD
SVSGMVCENPSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSGDSSV
LEDRCLNGLKETYASLGVPAAGNARTISIMKATVIGFITNNSQQKKLSTP
AGDCSALASEVGGYFDKVSSALA

3D structure

PDB

8el5 Molecular dissection of the soluble photosynthetic antenna from the cryptophyte alga Hemiselmis andersenii

Chain

Resolution

1.67 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AX9	F	C50 D54 S57 G58 C61 R129 I133 A136 T137 F141 S146 Q148 K149	C46 D50 S53 G54 C57 R125 I129 A132 T133 F137 S142 Q144 K145
BS02	PEB	F	M59 G72 R77 K78 A81 C82 R84 D85 I88 L120 V122 P123 G126 N127 T130	M55 G68 R73 K74 A77 C78 R80 D81 I84 L116 V118 P119 G122 N123 T126
BS03	PEB	F	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	K24 N31 K32 M34 D35 I138 N140 T149 P150 A151 G152 C154
BS04	PEB	F	N76 R77 A80	N72 R73 A76
BS05	PEB	F	N76 R77 A80	N72 R73 A76

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8el5, PDBe:8el5, PDBj:8el5
PDBsum	8el5
PubMed	37957226
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]