Structure of PDB 8e67 Chain F

Receptor sequence
>8e67F (length=97) Species: 10090 (Mus musculus) [Search protein sequence]
RIADSRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNH
KNRTNMTYEKMSRALRYYYKLNIIRKEPGQRLLFRFMKTPDEIMSGR
3D structure
PDB8e67 The functional role of histidine within the ETV6 ETS domain
ChainF
Resolution2.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F Y387 R392 R395 Y398 K405 L411 Y58 R63 R66 Y69 K76 L82
BS02 dna F L336 L337 W376 K380 K389 Y396 Y397 L7 L8 W47 K51 K60 Y67 Y68
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e67, PDBe:8e67, PDBj:8e67
PDBsum8e67
PubMed
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]