Structure of PDB 8e66 Chain F

Receptor sequence
>8e66F (length=92) Species: 10090 (Mus musculus) [Search protein sequence]
SRLLWDYVYQLLSDSRYENFIRWEDKESKIFRIVDPNGLARLWGNHKNRT
NMTYEKMSRALRYYYKLNIIRKEPGQRLLFRFMKTPDEIMSG
3D structure
PDB8e66 The functional role of histidine within the ETV6 ETS domain
ChainF
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F R392 R395 Y398 K405 R59 R62 Y65 K72
BS02 dna F L336 L337 W376 K380 R382 M385 K389 Y397 L3 L4 W43 K47 R49 M52 K56 Y64
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:8e66, PDBe:8e66, PDBj:8e66
PDBsum8e66
PubMed
UniProtP97360|ETV6_MOUSE Transcription factor ETV6 (Gene Name=Etv6)

[Back to BioLiP]