Structure of PDB 8e3d Chain F

Receptor sequence

>8e3dF (length=111) Species: 9606 (Homo sapiens) [Search protein sequence]

FQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVHMR
KHTGEKPYLCQQCGAAFAHNYDLKNHMRVHTGLRPYQCDSCCKTFVRSDH
LHRHLKKDGCN

3D structure

PDB

8e3d Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.

Chain

Resolution

2.62 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	dna	F	K389 Q392 R399 H400 T403 R421 V476 R477 H480	K9 Q12 R19 H20 T23 R41 V96 R97 H100
BS02	dna	F	K396 Q422 R430 N450 S478 D479 H482	K16 Q42 R50 N70 S98 D99 H102
BS03	ZN	F	C412 C415 H428 H432	C32 C35 H48 H52
BS04	ZN	F	C384 C387 H400 H404	C4 C7 H20 H24
BS05	ZN	F	C443 H456 H460	C63 H76 H80
BS06	ZN	F	C471 H484 C490	C91 H104 C110

External links

PDB	RCSB:8e3d, PDBe:8e3d, PDBj:8e3d
PDBsum	8e3d
PubMed	36626981
UniProt	O95365\|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]