Structure of PDB 8cgu Chain F

Receptor sequence
>8cguF (length=102) Species: 679895 (Escherichia coli BW25113) [Search protein sequence]
RHYEIVFMVHPDQSEQVPGMIERYTAAITGAEGKIHRLEDWGRRQLAYPI
NKLHKAHYVLMNVEAPQEVIDELETTFRFNDAVIRSMVMRTKHAVTEASP
MV
3D structure
PDB8cgu Structural conservation of antibiotic interaction with ribosomes.
ChainF
Resolution1.89 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R2 Y4 Y49 K53 Q68 R79 R86 M88 V89 M90 R91 R1 Y3 Y48 K52 Q67 R78 R85 M87 V88 M89 R90
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0048027 mRNA 5'-UTR binding
GO:0070181 small ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8cgu, PDBe:8cgu, PDBj:8cgu
PDBsum8cgu
PubMed37550453
UniProtP02358|RS6_ECOLI Small ribosomal subunit protein bS6 (Gene Name=rpsF)

[Back to BioLiP]