Structure of PDB 8cee Chain F

Receptor sequence

>8ceeF (length=185) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168)

ARYTGPSWKLSRRLGISLSGTGKELEKRPYAPGPHGEYGLQLQEKQKLRH
MYGVNERQFRTLFDKAGKLAGKHGENFMILLDSRLDNVVYKLGLARTRRQ
ARQLVNHGHILVDGSRVDIPSYLVKPGQTIGVREKSRNLSIIKESVPEYL
TFDAEKLEGTFTRLPERSELAPEINEALIVEFYSR

3D structure

• PDB: 8cee Structural basis of ribosomal 30S subunit degradation by RNase R
• Chain: F
• Resolution: 3.7 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	A2 R3 T5 P7 S8 W9 K10 R13 R14 K28 R29 Y31 P33 G34 P35 H36 Y47 L51 K54 Q55 R58 N64 E65 R66 Q67 R105 T106 R108 Q109 R111 Q112 N115 H116 H118 V126 D127 I128 P129 S130 Y131 L148 E196 S199 R200	A1 R2 T4 P6 S7 W8 K9 R12 R13 K27 R28 Y30 P32 G33 P34 H35 Y38 L42 K45 Q46 R49 N55 E56 R57 Q58 R96 T97 R99 Q100 R102 Q103 N106 H107 H109 V117 D118 I119 P120 S121 Y122 L139 E181 S184 R185

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation
• GO:0042274 ribosomal small subunit biogenesis

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8cee, PDBe:8cee, PDBj:8cee
• PDBsum: 8cee
• PubMed: 38326618
• UniProt: P21466|RS4_BACSU Small ribosomal subunit protein uS4 (Gene Name=rpsD)