Structure of PDB 8bq6 Chain F

Receptor sequence

>8bq6F (length=434) Species: 3702 (Arabidopsis thaliana)

EKTHFGGLKDEDRIFTNLYGLHDPFLKGAMKRGDWHRTKDLVLKGTDWIV
NEMKKSGLRGRGGAGFPSGLKWSFMPKVSDGRPSYLVVNADESEPGTCKD
REIMRHDPHKLLEGCLIAGVGMRASAAYIYIRGEYVNERLNLEKARREAY
AAGLLGKNACGSGYDFEVYIHFGAGAYICGEETALLESLEGKQGKPRLKP
PFPANAGLYGCPTTVTNVETVAVSPTILRRGPEWFSSFGRKNNAGTKLFC
ISGHVNKPCTVEEEMSIPLKELIERHCGGVRGGWDNLLAIIPGGSSVPLI
PKNICEDVLMDFDALKAVQSGLGTAAVIVMDKSTDVVDAIARLSYFYKHE
SCGQCTPCREGTGWLWMIMERMKVGNAKLEEIDMLQEVTKQIEGHTICAL
GDAAAWPVQGLIRHFRPELERRIRERAERELLQA

3D structure

• PDB: 8bq6 Cryo-EM structure of the respiratory I + III 2 supercomplex from Arabidopsis thaliana at 2 angstrom resolution.
• Chain: F
• Resolution: 2.8 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FMN	F	G110 R111 G112 K121 N139 D141 E142 Y227 G230 E231 E232 T266 N267 T270	G60 R61 G62 K71 N89 D91 E92 Y177 G180 E181 E182 T216 N217 T220
BS02	SF4	F	I228 P246 S401 C402 G403 Q404 C405 C408 T446 I447 C448 L450	I178 P196 S351 C352 G353 Q354 C355 C358 T396 I397 C398 L400

Gene Ontology

Molecular Function

• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005739 mitochondrion
• GO:0005743 mitochondrial inner membrane
• GO:0005886 plasma membrane
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:8bq6, PDBe:8bq6, PDBj:8bq6
• PDBsum: 8bq6
• PubMed: 36585502
• UniProt: Q9FNN5|NDUV1_ARATH NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial (Gene Name=At5g08530)