Structure of PDB 8agx Chain F

Receptor sequence

>8agxF (length=171) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]

AHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKV
KKASGEIVSINQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVA
AVETLYQDMAARHRARFRSIHILKVAEIEKTADVKRQYVKQFLTKDLKFP
LPHRVQKSTKTFSYKRPSTFY

3D structure

PDB

8agx Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control.

Chain

Resolution

2.4 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	A2 N62 N65 E66 H68 K71 S83 R84 S85 M90 Y91 K92 Q108 A111 A112 R113 H114 R115 R117 T132 R137 Y139 L144 T145 K146 P153 H154 R155 Q157 K158 S159 K161 Y165 S169 T170 F171	A1 N61 N64 E65 H67 K70 S82 R83 S84 M89 Y90 K91 Q107 A110 A111 R112 H113 R114 R116 T131 R136 Y138 L143 T144 K145 P152 H153 R154 Q156 K157 S158 K160 Y164 S168 T169 F170
BS02	rna	F	R13 S39 R40 Y43 Q46 H49 K50 K52 K53 R84 R119	R12 S38 R39 Y42 Q45 H48 K49 K51 K52 R83 R118

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:8agx, PDBe:8agx, PDBj:8agx
PDBsum	8agx
PubMed	36804914
UniProt	P0CX23\|RL20A_YEAST Large ribosomal subunit protein eL20A (Gene Name=RPL20A)

[Back to BioLiP]