Structure of PDB 8a1v Chain F

Receptor sequence

>8a1vF (length=406) Species: 666 (Vibrio cholerae)

STIIFGVVMFTLIILALVLVILFAKSKLVPTGDITISINGDPEKAIVTQP
GGKLLTALAGAGVFVSSACGGGGSCGQCRVKIKSGGGDILPTELDHISKG
EAREGERLACQVAVKADMDLELPEEIFGVKKWECTVISNDNKATFIKELK
LAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYE
SKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWS
LKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKS
KRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGY
TGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENI
LLDDFG

3D structure

• PDB: 8a1v Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: F
• Resolution: 2.73 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	F	R210 A211 Y212 S213 N227 V228 R229 A231 T232 V240 P241 P242 G243 Q244 M245 S246 A283 F406	R209 A210 Y211 S212 N226 V227 R228 A230 T231 V239 P240 P241 G242 Q243 M244 S245 A282 F405
BS02	FES	F	S68 C70 G72 G74 C76 G77 C79 C111	S67 C69 G71 G73 C75 G76 C78 C110

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding
• GO:0071949 FAD binding

Biological Process

• GO:0006814 sodium ion transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:8a1v, PDBe:8a1v, PDBj:8a1v
• PDBsum: 8a1v
• PubMed: 37710014
• UniProt: A5F5Y4|NQRF_VIBC3 Na(+)-translocating NADH-quinone reductase subunit F (Gene Name=nqrF)