Structure of PDB 8a1u Chain F

Receptor sequence

>8a1uF (length=405) Species: 666 (Vibrio cholerae)

STIIFGVVMFTLIILALVLVILFAKSKLVPTGDITISINGDPEKAIVTQP
GGKLLTALAGAGVFVSSACGGGGSCGQCRVKIKSGGGDILPTELDHISKG
EAREGERLACQVAVKADMDLELPEEIFGVKKWECTVISNDNKATFIKELK
LAIPDGESVPFRAGGYIQIEAPAHHVKYADFDVPEKYRGDWDKFNLFRYE
SKVDEPIIRAYSMANYPEEFGIIMLNVRIATPPPNNPNVPPGQMSSYIWS
LKAGDKCTISGPFGEFFAKDTDAEMVFIGGGAGMAPMRSHIFDQLKRLKS
KRKMSYWYGARSKREMFYVEDFDGLAAENDNFVWHCALSDPQPEDNWTGY
TGFIHNVLYENYLKDHEAPEDCEYYMCGPPMMNAAVINMLKNLGVEEENI
LLDDF

3D structure

• PDB: 8a1u Conformational coupling of redox-driven Na + -translocation in Vibrio cholerae NADH:quinone oxidoreductase.
• Chain: F
• Resolution: 2.86 Å

Enzymatic activity

• Enzyme Commision number: 7.2.1.1: NADH:ubiquinone reductase (Na(+)-transporting).

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	FAD	F	Y167 R210 A211 Y212 S213 A231 P234 V240 P241 G243 Q244 M245 A283 F406	Y166 R209 A210 Y211 S212 A230 P233 V239 P240 G242 Q243 M244 A282 F405
BS02	FES	F	C70 G72 G74 C76 G77 C79 C111	C69 G71 G73 C75 G76 C78 C110
BS03	NAI	F	S213 R229 G282 A283 G310 R312 S340 F354 C378 G379 P380 M382 M383 D404	S212 R228 G281 A282 G309 R311 S339 F353 C377 G378 P379 M381 M382 D403

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0016491 oxidoreductase activity
• GO:0016655 oxidoreductase activity, acting on NAD(P)H, quinone or similar compound as acceptor
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0006814 sodium ion transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:8a1u, PDBe:8a1u, PDBj:8a1u
• PDBsum: 8a1u
• PubMed: 37710014
• UniProt: Q9X4Q8|NQRF_VIBCH Na(+)-translocating NADH-quinone reductase subunit F (Gene Name=nqrF)