Structure of PDB 7zxy Chain F

Receptor sequence
>7zxyF (length=36) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MTAESMLANGAFIMIGLTLLGLAWGFVIIKLQGSEE
3D structure
PDB7zxy Cryo-EM structures of the Synechocystis sp. PCC 6803 cytochrome b6f complex with and without the regulatory PetP subunit.
ChainF
Resolution3.15 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide F M1 T2 M6 M14 L17 T18 G21 L22 W24 G25 F26 I28 I29 Q32 M1 T2 M6 M14 L17 T18 G21 L22 W24 G25 F26 I28 I29 Q32
BS02 ECH F T18 L19 L22 T18 L19 L22
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
Biological Process
GO:0015979 photosynthesis
Cellular Component
GO:0009512 cytochrome b6f complex
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zxy, PDBe:7zxy, PDBj:7zxy
PDBsum7zxy
PubMed35726684
UniProtP74810|PETM_SYNY3 Cytochrome b6-f complex subunit 7 (Gene Name=petM)

[Back to BioLiP]