Structure of PDB 7znj Chain F

Receptor sequence
>7znjF (length=382) Species: 9606 (Homo sapiens) [Search protein sequence]
MTKVEFETSEEVDVTPTFDTMGLREDLLRGIYAYGFEKPSAIQQRAIKQI
IKGRDVIAQSQSGTGKTATFSISVLQCLDIQVRETQALILAPTRELAVQI
QKGLLALGDYMNVQCHACIGGTNVGEDIRKLDYGQHVVAGTPGRVFDMIR
RRSLRTRAIKMLVLDEADEMLNKGFKEQIYDVYRYLPPATQVVLISATLP
HEILEMTNKFMTDPIRILVKRDELTLEGIKQFFVAVEREEWKFDTLCDLY
DTLTITQAVIFCNTKRKVDWLTEKMREANFTVSSMHGDMPQKERESIMKE
FRSGASRVLISTDVWARGLDVPQVSLIINYDLPNNRELYIHRIGRSGRYG
RKGVAINFVKNDDIRILRDIEQYYSTQIDEMP
3D structure
PDB7znj mRNA recognition and packaging by the human transcription-export complex.
ChainF
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.6.4.13: RNA helicase.
Interaction with ligand
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003723 RNA binding
GO:0003724 RNA helicase activity
GO:0003729 mRNA binding
GO:0004386 helicase activity
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008143 poly(A) binding
GO:0016787 hydrolase activity
GO:0016887 ATP hydrolysis activity
GO:0035368 selenocysteine insertion sequence binding
GO:0035613 RNA stem-loop binding
GO:0043021 ribonucleoprotein complex binding
Biological Process
GO:0000184 nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0000398 mRNA splicing, via spliceosome
GO:0006364 rRNA processing
GO:0006397 mRNA processing
GO:0006406 mRNA export from nucleus
GO:0006417 regulation of translation
GO:0008306 associative learning
GO:0008380 RNA splicing
GO:0010629 negative regulation of gene expression
GO:0014070 response to organic cyclic compound
GO:0017148 negative regulation of translation
GO:0035640 exploration behavior
GO:0045727 positive regulation of translation
GO:0048701 embryonic cranial skeleton morphogenesis
GO:0051028 mRNA transport
GO:0072715 cellular response to selenite ion
GO:0090394 negative regulation of excitatory postsynaptic potential
GO:0099578 regulation of translation at postsynapse, modulating synaptic transmission
GO:1904570 negative regulation of selenocysteine incorporation
GO:1990416 cellular response to brain-derived neurotrophic factor stimulus
GO:2000622 regulation of nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
Cellular Component
GO:0005634 nucleus
GO:0005654 nucleoplasm
GO:0005681 spliceosomal complex
GO:0005730 nucleolus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0016020 membrane
GO:0016607 nuclear speck
GO:0030425 dendrite
GO:0035145 exon-exon junction complex
GO:0043025 neuronal cell body
GO:0071006 U2-type catalytic step 1 spliceosome
GO:0071013 catalytic step 2 spliceosome
GO:0098794 postsynapse
GO:0098978 glutamatergic synapse
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7znj, PDBe:7znj, PDBj:7znj
PDBsum7znj
PubMed37020021
UniProtP38919|IF4A3_HUMAN Eukaryotic initiation factor 4A-III (Gene Name=EIF4A3)

[Back to BioLiP]