Structure of PDB 7zgr Chain F

Receptor sequence
>7zgrF (length=46) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
RIRRTTGIPKKFLKSIEMITDEGKFVVQVEDKQSWEDYQRKRENRQ
3D structure
PDB7zgr Mpe1 senses the binding of pre-mRNA and controls 3' end processing by CPF.
ChainF
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T212 I214 P215 K216 T6 I8 P9 K10
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0005515 protein binding
GO:0008270 zinc ion binding
GO:0036002 pre-mRNA binding
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
Biological Process
GO:0000209 protein polyubiquitination
GO:0006369 termination of RNA polymerase II transcription
GO:0006397 mRNA processing
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0016567 protein ubiquitination
GO:0030846 termination of RNA polymerase II transcription, poly(A)-coupled
Cellular Component
GO:0005634 nucleus
GO:0005829 cytosol
GO:0005847 mRNA cleavage and polyadenylation specificity factor complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7zgr, PDBe:7zgr, PDBj:7zgr
PDBsum7zgr
PubMed35584695
UniProtP35728|MPE1_YEAST Protein MPE1 (Gene Name=MPE1)

[Back to BioLiP]