Structure of PDB 7zci Chain F

Receptor sequence

>7zciF (length=442) Species: 562 (Escherichia coli)

MKNIIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEI
VNQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYK
DRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEA
TEAGLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSK
PPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNISKSKDAGTKLM
GFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARES
CGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAH
APGAVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLK

3D structure

• PDB: 7zci A universal coupling mechanism of respiratory complex I.
• Chain: F
• Resolution: 2.69 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	F	I179 S350 C351 G352 W353 C354 C357 F397 C398 H400	I179 S350 C351 G352 W353 C354 C357 F397 C398 H400
BS02	FMN	F	G61 G63 K72 N90 E93 G181 E182 E183 N217 N218	G61 G63 K72 N90 E93 G181 E182 E183 N217 N218
BS03	NAI	F	G63 G64 A65 F67 K72 E95 Y178 E183 F203 R320	G63 G64 A65 F67 K72 E95 Y178 E183 F203 R320

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain
• GO:0045333 cellular respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030964 NADH dehydrogenase complex
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7zci, PDBe:7zci, PDBj:7zci
• PDBsum: 7zci
• PubMed: 36104567
• UniProt: P31979|NUOF_ECOLI NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)