Structure of PDB 7zag Chain F

Receptor sequence

>7zagF (length=229) Species: 272844 (Pyrococcus abyssi GE5) [Search protein sequence]

SQEWKEYAKRVLDEWQPKTKLGMLVKEGQITDIHEIFRKGYQIKEPEIID
VLLPEVNARENQEILDIALTVRMTDSGRRVRFRVLAAVGNRDGYVGLGIG
HGREVGIAIRKAINYAKLNIIEIKRGCGSWECRCRRPHSVPFTVEGKEGS
VRVKLIPGPRGLGLVIGDVGKKILRLAGIQDVWSQTLGETRTTVNFAKAV
FNALYNTNKVVVTPEMIERYGIVVGRAMP

3D structure

PDB

7zag Role of aIF5B in archaeal translation initiation.

Chain

Resolution

2.77 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K45 T71 V72 R73 M74 D76 S77 R79 R82 R84 K112 K148 E149 S151 R153 V166 K172 W184 S185 T187 T191 R192 T193 N196 K199	K44 T70 V71 R72 M73 D75 S76 R78 R81 R83 K111 K147 E148 S150 R152 V165 K171 W183 S184 T186 T190 R191 T192 N195 K198
BS02	ZN	F	C128 C135 H139	C127 C134 H138

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0015935	small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7zag, PDBe:7zag, PDBj:7zag
PDBsum	7zag
PubMed	35694843
UniProt	Q9V1V5\|RS5_PYRAB Small ribosomal subunit protein uS5 (Gene Name=rps5)

[Back to BioLiP]