Structure of PDB 7z7r Chain F

Receptor sequence

>7z7rF (length=439) Species: 1403831 (Escherichia coli str. K-12 substr. MC4100)

IIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEIVNQ
VKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYKDRL
LMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEATEA
GLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSKPPF
PATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNISKSKDAGTKLMGFS
GRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFLTEA
HLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARESCGW
CTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAHAPG
AVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLK

3D structure

• PDB: 7z7r A universal coupling mechanism of respiratory complex I.
• Chain: F
• Resolution: 3.36 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	F	S350 C351 G352 W353 C354 C357 F397 C398 H400	S347 C348 G349 W350 C351 C354 F394 C395 H397
BS02	FMN	F	G61 R62 G63 N90 Y178 G181 E182 N217 N218 A399 H400	G58 R59 G60 N87 Y175 G178 E179 N214 N215 A396 H397

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain
• GO:0045333 cellular respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030964 NADH dehydrogenase complex
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7z7r, PDBe:7z7r, PDBj:7z7r
• PDBsum: 7z7r
• PubMed: 36104567
• UniProt: P31979|NUOF_ECOLI NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)