Structure of PDB 7yml Chain F

Receptor sequence
>7ymlF (length=54) Species: 1061 (Rhodobacter capsulatus) [Search protein sequence]
MSKFYKIWLVFDPRRVFVAQGVFLFLLAVLIHLILLSTPAFNWLTVATAK
HGYV
3D structure
PDB7yml Rhodobacter capsulatus forms a compact crescent-shaped LH1-RC photocomplex.
ChainF
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 SPO F F25 H32 L33 F25 H32 L33
BS02 SPO F F17 Q20 F23 L24 F17 Q20 F23 L24
BS03 BCL F R15 A19 F23 R15 A19 F23
BS04 BCL F L24 F25 H32 W43 L24 F25 H32 W43
BS05 BCL F L24 A28 I31 H32 L24 A28 I31 H32
BS06 BCL F F23 I31 F23 I31
BS07 SPO F F4 K6 I7 V10 F4 K6 I7 V10
Gene Ontology
Molecular Function
GO:0042314 bacteriochlorophyll binding
GO:0045156 electron transporter, transferring electrons within the cyclic electron transport pathway of photosynthesis activity
GO:0046872 metal ion binding
Biological Process
GO:0019684 photosynthesis, light reaction
Cellular Component
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0019866 organelle inner membrane
GO:0030076 light-harvesting complex
GO:0030077 plasma membrane light-harvesting complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yml, PDBe:7yml, PDBj:7yml
PDBsum7yml
PubMed36792596
UniProtP02948|LHA1_RHOCA Light-harvesting protein B-870 alpha chain (Gene Name=pufA)

[Back to BioLiP]