Structure of PDB 7x75 Chain F

Receptor sequence

>7x75F (length=301) Species: 100226 (Streptomyces coelicolor A3(2))

ATADPVKDYLKQIGKVPLLNAEQEVELAKRIEAGLFAEDKLANSDKLAPK
LKRELEIIAEDGRRAKNHLLEANLRLVVSLAKRYTGRGMLFLDLIQEGNL
GLIRAVEKFDYTKGYKFSTYATWWIRQAITRAMADQARTIRIPVHMVEVI
NKLARVQRQMLQDLGREPTPEELAKELDMTPEKVIEVQKYGREPISLHTP
LGEDGDSEFGDLIEDSEAVVPADAVSFTLLQEQLHSVLDTLSEREAGVVS
MRFGLTDGQPKTLDEIGKVYGVTRERIRQIESKTMSKLRHPSRSQVLRDY
L

3D structure

• PDB: 7x75 Structural basis of Streptomyces transcription activation by zinc uptake regulator.
• Chain: F
• Resolution: 3.45 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	V215 K216 L219 L227 A281 N282 R284 L285 K291 F300 R313 K317 K322 Y324 K325 S327 T328 T331 W332 W333 Q336 R340 R350 P352 H354 T482 E484 R485 Q488	V6 K7 L10 L18 A72 N73 R75 L76 K82 F91 R104 K108 K113 Y115 K116 S118 T119 T122 W123 W124 Q127 R131 R141 P143 H145 T273 E275 R276 Q279
BS02	dna	F	R292 R296 E357 R364 R367 E412 L472 D473 E474 R483 E484 R487	R83 R87 E148 R155 R158 E203 L263 D264 E265 R274 E275 R278

Gene Ontology

Molecular Function

• GO:0001108 bacterial-type RNA polymerase holo enzyme binding
• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0016987 sigma factor activity

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7x75, PDBe:7x75, PDBj:7x75
• PDBsum: 7x75
• PubMed: 35871291
• UniProt: P18183|SIGA_STRCO RNA polymerase principal sigma factor HrdB (Gene Name=hrdB)