Structure of PDB 7vyq Chain F

Receptor sequence

>7vyqF (length=280) Species: 5480 (Candida parapsilosis)

SMGEIESYCNKELGPLPTKAPTLSKNVLDLFSLKGKVASVTGSSGGIGWA
VAEAYAQAGADVAIWYNSHPADEKAEHLQKTYGVHSKAYKCNISDPKSVE
ETISQQEKDFGTIDVFVANAGVTWTQGPEIDVDNYDSWNKIISVDLNGVY
YCSHNIGKIFKKNGKGSLIITSSISGKIVNIPQLQAPYNTAKAACTHLAK
SLAIEWAPFARVNTISPGYIDTDITDFASKDMKAKWWQLTPLGREGLTQE
LVGGYLYLASNASTFTTGSDVVIDGGYTCP

3D structure

• PDB: 7vyq Oligomeric interactions maintain active-site structure in a noncooperative enzyme family.
• Chain: F
• Resolution: 3.13 Å

Enzymatic activity

• Enzyme Commision number: 1.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	F	G41 S43 G44 G45 I46 N66 S67 H68 I92 N118 A119 G120 V143 S172 Y187 K191 P216 G217 I219 T221 I223 T224	G42 S44 G45 G46 I47 N67 S68 H69 I93 N119 A120 G121 V144 S173 Y188 K192 P217 G218 I220 T222 I224 T225
BS02	83I	F	T122 S172 Q182 Y218 F226 W235	T123 S173 Q183 Y219 F227 W236

Gene Ontology

Molecular Function

• GO:0000166 nucleotide binding
• GO:0003674 molecular_function
• GO:0016491 oxidoreductase activity
• GO:0046872 metal ion binding
• GO:0050664 oxidoreductase activity, acting on NAD(P)H, oxygen as acceptor

Biological Process

• GO:0008150 biological_process

Cellular Component

• GO:0005575 cellular_component

External links

• PDB: RCSB:7vyq, PDBe:7vyq, PDBj:7vyq
• PDBsum: 7vyq
• PubMed: 35801308
• UniProt: G8BHG6