Structure of PDB 7uov Chain F |
>7uovF (length=97) Species: 9606 (Homo sapiens) [Search protein sequence] |
LSLSCTVDGESFNGFFWTWIRQPPGKGLEWIGEINHLASTGYNPSLKSRV TISVDTSKNQFSLKLTSVTAADTAVYYCARGYSYGFAWPNYHYLDVW |
|
PDB | 7uov A cocktail of protective antibodies subverts the dense glycan shield of Lassa virus. |
Chain | F |
Resolution | 2.75 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MAN |
F |
E27 S28 |
E10 S11 |
|
|
|