Structure of PDB 7unr Chain F

Receptor sequence
>7unrF (length=176) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
RLKEIYRKEIAPKLKEELQLANVMEVPRVTKITLNMGLGEAVGDKKIIEN
AVADLEKITGQKPVVTYARKSIAGFKIREGWPIGVKVTLRSDRMYEFLDR
LLSISLPRVRDFRGLNAKSFDGRGNYSMGVKEQIIFPEIDYDKIDALRGL
DITLTTTARTDDEGRALLRAFKFPFR
3D structure
PDB7unr Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F S73 A75 R80 S71 A73 R78
BS02 rna F T35 N37 M38 G39 G41 T68 A70 R71 I74 F77 S121 D123 R125 S129 G151 D153 T155 T33 N35 M36 G37 G39 T66 A68 R69 I72 F75 S119 D121 R123 S127 G149 D151 T153
BS03 rna F N24 M26 Q63 K64 V66 T90 R92 N22 M24 Q61 K62 V64 T88 R90
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unr, PDBe:7unr, PDBj:7unr
PDBsum7unr
PubMed
UniProtQ9HWE7|RL5_PSEAE Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]