Structure of PDB 7ucj Chain F

Receptor sequence

>7ucjF (length=225) Species: 9986 (Oryctolagus cuniculus)

NFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIRMAR
MARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFV
KLNKASINMLRIVEPYIAWGYPNLKSVNELIYKRGYGKINKKRIALTDNT
LIARSLGKYNIICMEDLIHEIYTVGKHFKEANNFLWPFKLSSPRGGMKKK
TTHFVEGGDAGNREDQINRLIRRMN

3D structure

• PDB: 7ucj Direct epitranscriptomic regulation of mammalian translation initiation through N4-acetylcytidine.
• Chain: F
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	F24 I29 K30 R31 R33 F36 R45 K47 Y50 E51 H57 Y60 Q62 Y64 R65 R72 M73 R75 R95 G96 N98 P102 K106 V107 L110 R112 Q115 I116 A127 N130 L146 N150 K155 R156 K164 R165 T172 R176 G179 K180 I184 E187 K201 N205 K211 L212 S213 S214 R216 G217 G218 M219 K221 K222 R241 R244	F2 I7 K8 R9 R11 F14 R23 K25 Y28 E29 H35 Y38 Q40 Y42 R43 R50 M51 R53 R73 G74 N76 P80 K84 V85 L88 R90 Q93 I94 A105 N108 L124 N128 K133 R134 K142 R143 T150 R154 G157 K158 I162 E165 K179 N183 K189 L190 S191 S192 R194 G195 G196 M197 K199 K200 R219 R222
BS02	rna	F	T223 H225 E228	T201 H203 E206

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7ucj, PDBe:7ucj, PDBj:7ucj
• PDBsum: 7ucj
• PubMed: 35679869
• UniProt: G1SV32|RL7_RABIT Large ribosomal subunit protein uL30 (Gene Name=RPL7)