Structure of PDB 7ttw Chain F

Receptor sequence
>7ttwF (length=87) Species: 1280 (Staphylococcus aureus) [Search protein sequence]
RDILKRPVITEKSSEAMAEDKYTFDVDTRVNKTQVKMAVEEIFNVKVASV
NIMNYKPKKKRMGRYQGYTNKRRKAIVTLKEGSDDLF
3D structure
PDB7ttw A Structurally Characterized Staphylococcus aureus Evolutionary Escape Route from Treatment with the Antibiotic Linezolid.
ChainF
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F T13 K15 N34 K35 T36 K39 N54 M56 Y58 K59 K63 M65 Y68 G70 N73 R76 T10 K12 N31 K32 T33 K36 N51 M53 Y55 K56 K60 M62 Y65 G67 N70 R73
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ttw, PDBe:7ttw, PDBj:7ttw
PDBsum7ttw
PubMed35736238
UniProtQ2FW08|RL23_STAA8 Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]