Structure of PDB 7tap Chain F

Receptor sequence

>7tapF (length=159) Species: 4932 (Saccharomyces cerevisiae)

MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLL
FKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLS
GLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLL
NSRATQDVV

3D structure

• PDB: 7tap Cryo-EM of the Yeast V O Complex Reveals Distinct Binding Sites for Macrolide V-ATPase Inhibitors.
• Chain: F
• Resolution: 2.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	KJL	F	I58 G61 I62 I65 Y66 E137	I58 G61 I62 I65 Y66 E137
BS02	KJL	F	F135 V138 Y142	F135 V138 Y142

Gene Ontology

Molecular Function

• GO:0015078 proton transmembrane transporter activity
• GO:0046961 proton-transporting ATPase activity, rotational mechanism

Biological Process

• GO:0006623 protein targeting to vacuole
• GO:0006878 intracellular copper ion homeostasis
• GO:0006879 intracellular iron ion homeostasis
• GO:0006897 endocytosis
• GO:0007033 vacuole organization
• GO:0007035 vacuolar acidification
• GO:0048388 endosomal lumen acidification
• GO:0061795 Golgi lumen acidification
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0000139 Golgi membrane
• GO:0000220 vacuolar proton-transporting V-type ATPase, V0 domain
• GO:0000329 fungal-type vacuole membrane
• GO:0005773 vacuole
• GO:0005774 vacuolar membrane
• GO:0016020 membrane
• GO:0016471 vacuolar proton-transporting V-type ATPase complex
• GO:0033176 proton-transporting V-type ATPase complex
• GO:0033177 proton-transporting two-sector ATPase complex, proton-transporting domain
• GO:0033179 proton-transporting V-type ATPase, V0 domain

External links

• PDB: RCSB:7tap, PDBe:7tap, PDBj:7tap
• PDBsum: 7tap
• PubMed: 35148071
• UniProt: P25515|VATL1_YEAST V-type proton ATPase subunit c (Gene Name=VMA3)