Structure of PDB 7szt Chain F |
>7sztF (length=89) Species: 9606 (Homo sapiens) [Search protein sequence] |
SVPTKLEVVAATPTSLLISWDAGHWWEWVTYYRITYGETGGNSPVQEFTV PGYSSTATISGLKPGVDYTITVYAPTSDYGSPISINYRT |
|
PDB | 7szt Crystal structures of bacterial small multidrug resistance transporter EmrE in complex with structurally diverse substrates. |
Chain | F |
Resolution | 2.32 Å |
3D structure |
|
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
9PD |
F |
P54 Y56 |
P51 Y53 |
|
|
|