Structure of PDB 7syx Chain F

Receptor sequence

>7syxF (length=262) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

ARGPKKHLKRVAAPKHWMLDKLTGVFAPRPSTGPHKLRECLPLIIFLRNK
LKYALTGDEVKKICMQRFIKIDGKVRADITYPAGFMDVISIDKTGENFRL
IYDTKGRFAVHRITPEEAKYKLCKVRKIFVGTKGIPHLVTHDARTIRYPD
PLIKMNDTIQIDLETGKITDFIKFDTGNLCMVTGGANLGRIGVITNRERH
PGSFDVVHVKDANGNSFATRLSNIFVIGKGNKPWISLPRGKGIRLTIAEE
RDKRLAAKQSSG

3D structure

PDB

7syx Molecular architecture of 40S translation initiation complexes on the hepatitis C virus IRES.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	A2 R3 G4 K6 K7 H8 K10 V12 K16 M19 D21 K22 L23 F27 P29 R30 T33 G34 K37 R49 M66 R77 K106 R108 K128 G132 T133 K134 A144 T146 K155 G186 A187 G203 A219 R221 R255	A1 R2 G3 K5 K6 H7 K9 V11 K15 M18 D20 K21 L22 F26 P28 R29 T32 G33 K36 R48 M65 R76 K105 R107 K127 G131 T132 K133 A143 T145 K154 G185 A186 G202 A218 R220 R254

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022626	cytosolic ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7syx, PDBe:7syx, PDBj:7syx
PDBsum	7syx
PubMed	35822879
UniProt	G1TK17\|RS4X_RABIT Small ribosomal subunit protein eS4 (Gene Name=RPS4X)

[Back to BioLiP]