Structure of PDB 7sut Chain F

Receptor sequence

>7sutF (length=176) Species: 464988 (Hemiselmis andersenii) [Search protein sequence]

MLDAFSKVITSADGKAAYVGGADLQALKKFVSEGNKRMDSVNAIVSNASC
IVSDSVSGMVCENPSLIAPNGGVYTNRKMAACLRDAEIILRYVSYSLLSG
DSSVLEDRCLNGLKETYASLGVPAAGNARTISIMKATVIGFITNNSQQKK
LSTPAGDCSALASEVGGYFDKVSSAL

3D structure

PDB

7sut MX2: a high-flux undulator microfocus beamline serving both the chemical and macromolecular crystallography communities at the Australian Synchrotron.

Chain

Resolution

1.49 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	AX9	F	C50 D54 S57 G58 C61 A136 T137 F141 N145 Q147 Q148	C50 D54 S57 G58 C61 A136 T137 F141 N145 Q147 Q148
BS02	PEB	F	M59 G72 V73 R77 K78 A81 C82 R84 D85 I88 L113 T116 L120 V122 P123 G126 N127	M59 G72 V73 R77 K78 A81 C82 R84 D85 I88 L113 T116 L120 V122 P123 G126 N127
BS03	PEB	F	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158	K28 N35 K36 M38 D39 I142 N144 T153 P154 A155 G156 C158
BS04	X2I	F	P64 S65	P64 S65
BS05	AX9	F	Q147 Q148 K150	Q147 Q148 K150

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009535	chloroplast thylakoid membrane
GO:0009579	thylakoid
GO:0016020	membrane
GO:0030089	phycobilisome

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7sut, PDBe:7sut, PDBj:7sut
PDBsum	7sut
PubMed	37957226
UniProt	U5T8W0\|PHEB_HEMAN Phycoerythrin beta subunit

[Back to BioLiP]