Structure of PDB 7ryh Chain F

Receptor sequence
>7ryhF (length=174) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
LKARYNDELKAKLQEELSIKNVMEIPRITKITLNMGVGAAATDKKLLDGA
VADMQLIAGQKPVVTLARKSIAGFKIRDGWPIGCKVTLRGDQMYEFLDRL
ISIAIPRIRDFRGFSAKSFDGRGNYSMGLKEQIVFPEIDFDKIDRIRGMD
ITITTTARTDDEGRALMRAFGFPF
3D structure
PDB7ryh An Analysis of the Novel Fluorocycline TP-6076 Bound to Both the Ribosome and Multidrug Efflux Pump AdeJ from Acinetobacter baumannii.
ChainF
Resolution2.43 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F K33 N37 G39 G41 F77 I79 I85 S121 D123 R125 S129 M130 G131 K133 D153 K30 N34 G36 G38 F74 I76 I82 S118 D120 R122 S126 M127 G128 K130 D150
BS02 rna F N24 K64 V66 K88 T90 R92 N21 K61 V63 K85 T87 R89
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7ryh, PDBe:7ryh, PDBj:7ryh
PDBsum7ryh
PubMed35100868
UniProtB7IA27|RL5_ACIB5 Large ribosomal subunit protein uL5 (Gene Name=rplE)

[Back to BioLiP]