Structure of PDB 7rdq Chain F

Receptor sequence

>7rdqF (length=349) Species: 300852 (Thermus thermophilus HB8)

ISTSDPVRQYLHEIGQVPLLTLEEEVELARKVEEGMEAIKKLSEITGLDP
DLIREVVRAKILGSARVRHIPGLKETLDPKTVEEIDQKLKSLPKEHKRYL
HIAREGEAARQHLIEANLRLVVSIAKKYTGRGLSFLDLIQEGNQGLIRAV
EKFEYKRRFKFSTYATWWIRQAINRAIADQARTIRIPVHMVETINKLSRT
ARQLQQELGREPTYEEIAEAMGPGWDAKRVEETLKIAQEPVSLETPIGDE
KDSFYGDFIPDEHLPSPVDAATQSLLSEELEKALSKLSEREAMVLKLRKG
LIDGREHTLEEVGAFFGVTRERIRQIENKALRKLKYHESRTRKLRDFLD

3D structure

• PDB: 7rdq Structural and mechanistic basis of reiterative transcription initiation.
• Chain: F
• Resolution: 3.0 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	F	V81 L85 G89 R193 L194 K200 F209 R222 K226 R231 F233 K234 S236 T237 Y238 T240 W242 Q245 R249 R259 P261 H263	V7 L11 G15 R119 L120 K126 F135 R148 K152 R157 F159 K160 S162 T163 Y164 T166 W168 Q171 R175 R185 P187 H189
BS02	dna	F	K201 R205 R273 R276 I321	K127 R131 R199 R202 I247
BS03	rna	F	I75 S76 T77 D323 E324 K325 D326	I1 S2 T3 D249 E250 K251 D252
BS04	MG	F	A292 E293	A218 E219

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0016987 sigma factor activity
• GO:0046872 metal ion binding

Biological Process

• GO:0006352 DNA-templated transcription initiation
• GO:0006355 regulation of DNA-templated transcription
• GO:0010468 regulation of gene expression
• GO:2000142 regulation of DNA-templated transcription initiation

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:7rdq, PDBe:7rdq, PDBj:7rdq
• PDBsum: 7rdq
• PubMed: 35082149
• UniProt: Q5SKW1