Structure of PDB 7r3k Chain F

Receptor sequence

>7r3kF (length=165) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]

DIAGLTPCSESKAYAKLEKKELKTLEKRLKQYEADSAPAVALKATMERTK
ARFANYAKAGLLCGNDGLPHLIADPGLALKYGHAGEVFIPTFGFLYVAGY
IGYVGRQYLIAVKGEAKPTDKEIIIDVPLATKLAWQGAGWPLAAVQELQR
GTLLEKEENITVSPR

3D structure

PDB

7r3k Structure of Photosystem I Supercomplex Isolated from a Chlamydomonas reinhardtii Cytochrome b6f Temperature-Sensitive Mutant.

Chain

Resolution

2.52 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	F	G164 G167 Y170	G102 G105 Y108
BS02	CLA	F	Y170 L171 E184	Y108 L109 E122
BS03	CLA	F	Y158 V159	Y96 V97
BS04	CLA	F	D136 P137 G138	D74 P75 G76
BS05	CLA	F	T153 F156 A160 W202	T91 F94 A98 W140
BS06	CLA	F	V159 Y162 I163 A196	V97 Y100 I101 A134
BS07	RRX	F	P137 T153 G161 G164 W202	P75 T91 G99 G102 W140
BS08	CLA	F	A200 V207	A138 V145
BS09	ERG	F	Q208 Q211 R212	Q146 Q149 R150

Gene Ontology

	Molecular Function
GO:0005515	protein binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009507	chloroplast
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009543	chloroplast thylakoid lumen
GO:0009579	thylakoid

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7r3k, PDBe:7r3k, PDBj:7r3k
PDBsum	7r3k
PubMed	36979472
UniProt	P12356\|PSAF_CHLRE Photosystem I reaction center subunit III, chloroplastic (Gene Name=PSAF)

[Back to BioLiP]