Structure of PDB 7qgg Chain F

Receptor sequence

>7qggF (length=294) Species: 10116 (Rattus norvegicus) [Search protein sequence]

VKVVKNKAYFKRYQVRFRRRREGKTDYYARKRLVIQDKNKYNTPKYRMIV
RVTNRDIICQIAYARIEGDMIVCAAYAHELPKYGVKVGLTNYAAAYCTGL
LLARRLLNRFGMDKIYEGQVEVNGDEYNVESIDGQPGAFTCYLDAGLART
TTGNKVFGALKGAVDGGLSIPHSTKRFPGYDSESKEFNAEVHRKHIMGQN
VADYMRYLMEEDEDAYKKQFSQYIKNNVTPDMMEEMYKKAHAAIRENPVY
EKKPKREVKKKRWNRPKMSLAQKKDRVAQKKASFLRAQERAAES

3D structure

PDB

7qgg Neuronal RNA granules are ribosome complexes stalled at the pre-translocation state.

Chain

Resolution

2.86 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K10 F13 K14 Y16 V18 F20 R21 R22 R24 T28 Y30 R33 R50 R54 T56 N57 R58 I69 D72 M73 I74 N94 R152 T155 N157 K158 N203 V204 Y207 Q222 F223 S224 Q225 Y226 Y253 K255 K256 R259 V261 W266 R268 P269 K270 M271 L273 K276 K277 R279 V280	K7 F10 K11 Y13 V15 F17 R18 R19 R21 T25 Y27 R30 R47 R51 T53 N54 R55 I66 D69 M70 I71 N91 R149 T152 N154 K155 N200 V201 Y204 Q219 F220 S221 Q222 Y223 Y250 K252 K253 R256 V258 W263 R265 P266 K267 M268 L270 K273 K274 R276 V277
BS02	rna	F	V4 K5 K10 A11 R15 Y16 Q17 R23 G26 T28 D29 R35 L36 K43 Y44 K48 F113 P139 G140 Y145 L150 R152 T153 F160 S176 R179 R268 S272 A274 Q275 D278 R279 Q282 K283 S286 F287 R289 A290	V1 K2 K7 A8 R12 Y13 Q14 R20 G23 T25 D26 R32 L33 K40 Y41 K45 F110 P136 G137 Y142 L147 R149 T150 F157 S173 R176 R265 S269 A271 Q272 D275 R276 Q279 K280 S283 F284 R286 A287

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003730	mRNA 3'-UTR binding
GO:0003735	structural constituent of ribosome
GO:0005515	protein binding
GO:0008097	5S rRNA binding
GO:0019843	rRNA binding
GO:0031625	ubiquitin protein ligase binding
GO:0048027	mRNA 5'-UTR binding
GO:1990948	ubiquitin ligase inhibitor activity

	Biological Process
GO:0000027	ribosomal large subunit assembly
GO:0006364	rRNA processing
GO:0006412	translation
GO:0010628	positive regulation of gene expression
GO:0042273	ribosomal large subunit biogenesis
GO:0045727	positive regulation of translation
GO:0050821	protein stabilization
GO:1901796	regulation of signal transduction by p53 class mediator
GO:2000059	negative regulation of ubiquitin-dependent protein catabolic process
GO:2000435	negative regulation of protein neddylation

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0014069	postsynaptic density
GO:0017101	aminoacyl-tRNA synthetase multienzyme complex
GO:0022625	cytosolic large ribosomal subunit
GO:0022626	cytosolic ribosome
GO:0032991	protein-containing complex
GO:0045202	synapse
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7qgg, PDBe:7qgg, PDBj:7qgg
PDBsum	7qgg
PubMed	36038000
UniProt	P09895\|RL5_RAT Large ribosomal subunit protein uL18 (Gene Name=Rpl5)

[Back to BioLiP]