Structure of PDB 7q08 Chain F

Receptor sequence

>7q08F (length=260) Species: 237561 (Candida albicans SC5314) [Search protein sequence]

ARGPKKHLKRLAAPSHWMLDKLSGTYAPRPSAGPHKLRESLPLVVFLRNR
LKYALNGREVKAIMMQQHVQVDGKVRTDTTYPAGFMDVITLEATNEHFRL
VYDVKGKFAVHRISAEEAAYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PLIRANDTVKIDLATGKIDDFIKFDTGRLVMVTGGRNLGRVGVIVHREKH
EGGFDLVHIKDALENTFVTRLSNVFVIGTEAGKPWVSLPKGKGIKLSISE
ERDRRRAQQG

3D structure

PDB

7q08 E-site drug specificity of the human pathogen Candida albicans ribosome.

Chain

Resolution

2.56 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R3 G4 P5 K6 K7 H8 K10 L12 M19 D21 K22 Y27 A28 P29 R30 A33 G34 K37 L38 R49 N57 G58 R59 M66 R77 K106 Q130 L131 G132 K133 K134 G135 Y138 V140 R145 T146 R148 R155 T177 G186 R187 H197 H201 G203 E252 R256	R2 G3 P4 K5 K6 H7 K9 L11 M18 D20 K21 Y26 A27 P28 R29 A32 G33 K36 L37 R48 N56 G57 R58 M65 R76 K105 Q129 L130 G131 K132 K133 G134 Y137 V139 R144 T145 R147 R154 T176 G185 R186 H196 H200 G202 E251 R255

Gene Ontology

	Molecular Function
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome
GO:0019843	rRNA binding

	Biological Process
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022627	cytosolic small ribosomal subunit
GO:1990904	ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7q08, PDBe:7q08, PDBj:7q08
PDBsum	7q08
PubMed	35613268
UniProt	A0A1D8PCI6\|RS4_CANAL Small ribosomal subunit protein eS4 (Gene Name=RPS42)

[Back to BioLiP]