Structure of PDB 7pia Chain F

Receptor sequence

>7piaF (length=154) Species: 272634 (Mycoplasmoides pneumoniae M129)

RKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGAFDLIEQ
RTKEKPLTVFERAVGNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALR
WIAMFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFA
HMRW

3D structure

• PDB: 7pia Visualizing translation dynamics at atomic detail inside a bacterial cell.
• Chain: F
• Resolution: 13.6 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	R2 K3 N4 R5 A6 P7 K8 R9 T10 V11 R24 N27 I29 M30 E31 D32 G33 K34 K35 G36 L37 A38 R40 I41 R75 V76 R77 R78 S82 D93 R94 A97 R101 K109 H111 E112 K113 M115 K118 I119	R1 K2 N3 R4 A5 P6 K7 R8 T9 V10 R23 N26 I28 M29 E30 D31 G32 K33 K34 G35 L36 A37 R39 I40 R74 V75 R76 R77 S81 D92 R93 A96 R100 K108 H110 E111 K112 M114 K117 I118

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0015935 small ribosomal subunit
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7pia, PDBe:7pia, PDBj:7pia
• PDBsum: 7pia
• PubMed: 36171285
• UniProt: P75545|RS7_MYCPN Small ribosomal subunit protein uS7 (Gene Name=rpsG)