Structure of PDB 7pi8 Chain F

Receptor sequence
>7pi8F (length=154) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
RKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGAFDLIEQ
RTKEKPLTVFERAVGNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALR
WIAMFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFA
HMRW
3D structure
PDB7pi8 Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainF
Resolution8.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R2 K3 N4 R5 A6 P7 R9 R24 N27 I29 M30 E31 D32 G33 K34 K35 L37 A38 R40 I41 R75 V76 R77 R78 S82 R94 R101 K109 K113 R1 K2 N3 R4 A5 P6 R8 R23 N26 I28 M29 E30 D31 G32 K33 K34 L36 A37 R39 I40 R74 V75 R76 R77 S81 R93 R100 K108 K112
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pi8, PDBe:7pi8, PDBj:7pi8
PDBsum7pi8
PubMed36171285
UniProtP75545|RS7_MYCPN Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]