Structure of PDB 7paj Chain F

Receptor sequence
>7pajF (length=154) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
RKNRAPKRTVLPDPVFNNTLVTRIINVIMEDGKKGLAQRILYGAFDLIEQ
RTKEKPLTVFERAVGNVMPRLELRVRRIAGSNYQVPTEVPQDRKIALALR
WIAMFARKRHEKTMLEKIANEIIDASNNTGAAIKKKDDTHKMAEANKAFA
HMRW
3D structure
PDB7paj Visualizing translation dynamics at atomic detail inside a bacterial cell.
ChainF
Resolution7.3 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna F R2 K3 R5 K8 R9 N27 E31 D32 G33 K34 K35 L37 R40 R75 V76 R78 S82 R94 R101 K113 M115 R1 K2 R4 K7 R8 N26 E30 D31 G32 K33 K34 L36 R39 R74 V75 R77 S81 R93 R100 K112 M114
BS02 rna F N83 K142 M143 E145 A146 N147 N82 K141 M142 E144 A145 N146
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7paj, PDBe:7paj, PDBj:7paj
PDBsum7paj
PubMed36171285
UniProtP75545|RS7_MYCPN Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]