Structure of PDB 7p62 Chain F

Receptor sequence

>7p62F (length=442) Species: 469008 (Escherichia coli BL21(DE3))

MKNIIRTPETHPLTWRLRDDKQPVWLDEYRSKNGYEGARKALTGLSPDEI
VNQVKDAGLKGRGGAGFSTGLKWSLMPKDESMNIRYLLCNADEMEPGTYK
DRLLMEQLPHLLVEGMLISAFALKAYRGYIFLRGEYIEAAVNLRRAIAEA
TEAGLLGKNIMGTGFDFELFVHTGAGRYICGEETALINSLEGRRANPRSK
PPFPATSGAWGKPTCVNNVETLCNVPAILANGVEWYQNISKSKDAGTKLM
GFSGRVKNPGLWELPFGTTAREILEDYAGGMRDGLKFKAWQPGGAGTDFL
TEAHLDLPMEFESIGKAGSRLGTALAMAVDHEINMVSLVRNLEEFFARES
CGWCTPCRDGLPWSVKILRALERGEGQPGDIETLEQLCRFLGPGKTFCAH
APGAVEPLQSAIKYFREEFEAGIKQPFSNTHLINGIQPNLLK

3D structure

• PDB: 7p62 A universal coupling mechanism of respiratory complex I.
• Chain: F
• Resolution: 3.6 Å

Enzymatic activity

• Enzyme Commision number: 7.1.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	SF4	F	I179 S350 C351 C354 C357 C398 H400	I179 S350 C351 C354 C357 C398 H400
BS02	FMN	F	G61 G63 K72 N90 D92 E93 Y178 G181 E182 N217 N218 A399 H400	G61 G63 K72 N90 D92 E93 Y178 G181 E182 N217 N218 A399 H400

Gene Ontology

Molecular Function

• GO:0003954 NADH dehydrogenase activity
• GO:0008137 NADH dehydrogenase (ubiquinone) activity
• GO:0010181 FMN binding
• GO:0046872 metal ion binding
• GO:0048038 quinone binding
• GO:0051287 NAD binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0009060 aerobic respiration
• GO:0022904 respiratory electron transport chain
• GO:0045333 cellular respiration
• GO:1902600 proton transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:0030964 NADH dehydrogenase complex
• GO:0045271 respiratory chain complex I

External links

• PDB: RCSB:7p62, PDBe:7p62, PDBj:7p62
• PDBsum: 7p62
• PubMed: 36104567
• UniProt: P31979|NUOF_ECOLI NADH-quinone oxidoreductase subunit F (Gene Name=nuoF)