Structure of PDB 7onu Chain F

Receptor sequence

>7onuF (length=276) Species: 9606 (Homo sapiens) [Search protein sequence]

AATREFIEMWRLLGREVPEHITEEELKTLMECVSNTAKKKYLKYLYTKEK
VKKARQIKKEMKAAAKNFLFLRLWDRNMDIAMGWKGAQAMQFGQPLVFDM
AYENYMKRKELQNTVSQLLESEGWNRRNVDPFHIYFCNLKIDGALHRELV
KRYQEKWDKLLLTSTEKSHVDLFPKDSIIYLTADSPNVMTTFRHDKVYVI
GSFVDKSMQPGTSLAKAKRLNLATECLPLDKYLQWEIGNKNLTLDQMIRI
LLCLKNNGNWQEALQFVPKRKHTGFL

3D structure

PDB

7onu Structural basis of RNA processing by human mitochondrial RNase P.

Chain

Resolution

3.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

2.1.1.-
2.1.1.218: tRNA (adenine(9)-N(1))-methyltransferase.
2.1.1.221: tRNA (guanine(9)-N(1))-methyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	S125 T127 K131 Y135 K141 V142 K143 R146 K149 F177 R181 L182 D184 R185 K218 N222 Q226 E229 R235 R236 R261 V313 K315 M317 W344 E345 N348 K349 T352 D354 Q355 P377 K378 R379	S34 T36 K40 Y44 K50 V51 K52 R55 K58 F68 R72 L73 D75 R76 K109 N113 Q117 E120 R126 R127 R152 V204 K206 M208 W235 E236 N239 K240 T243 D245 Q246 P268 K269 R270

Gene Ontology

	Molecular Function
GO:0000049	tRNA binding
GO:0003723	RNA binding
GO:0005515	protein binding
GO:0008168	methyltransferase activity
GO:0042802	identical protein binding
GO:0052905	tRNA (guanosine(9)-N1)-methyltransferase activity
GO:0160106	tRNA (adenine(9)-N1)-methyltransferase activity

	Biological Process
GO:0000964	mitochondrial RNA 5'-end processing
GO:0006397	mRNA processing
GO:0008033	tRNA processing
GO:0032259	methylation
GO:0070131	positive regulation of mitochondrial translation
GO:0070901	mitochondrial tRNA methylation
GO:0090646	mitochondrial tRNA processing
GO:0097745	mitochondrial tRNA 5'-end processing
GO:1990180	mitochondrial tRNA 3'-end processing

	Cellular Component
GO:0005634	nucleus
GO:0005654	nucleoplasm
GO:0005739	mitochondrion
GO:0005759	mitochondrial matrix
GO:0030678	mitochondrial ribonuclease P complex
GO:0042645	mitochondrial nucleoid
GO:0043527	tRNA methyltransferase complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:7onu, PDBe:7onu, PDBj:7onu
PDBsum	7onu
PubMed	34489609
UniProt	Q7L0Y3\|TM10C_HUMAN tRNA methyltransferase 10 homolog C (Gene Name=TRMT10C)

[Back to BioLiP]