Structure of PDB 7n5v Chain F

Receptor sequence
>7n5vF (length=56) Species: 9606 (Homo sapiens) [Search protein sequence]
KAFQKCPICEKVIQGAGKLPRHIRTHTGEKPYECNICKVRFTRQDKLKVH
MRKHTG
3D structure
PDB7n5v Structural basis for transcription factor ZBTB7A recognition of DNA and effects of ZBTB7A somatic mutations that occur in human acute myeloid leukemia.
ChainF
Resolution3.08 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna F E407 K408 R418 E29 K30 R40
BS02 dna F Q392 R399 H400 R421 Q14 R21 H22 R43
BS03 dna F A394 K396 Q422 D423 K426 A16 K18 Q44 D45 K48
BS04 ZN F C412 C415 H428 H432 C34 C37 H50 H54
BS05 ZN F C384 C387 H400 H404 C6 C9 H22 H26
External links
PDB RCSB:7n5v, PDBe:7n5v, PDBj:7n5v
PDBsum7n5v
PubMed36626981
UniProtO95365|ZBT7A_HUMAN Zinc finger and BTB domain-containing protein 7A (Gene Name=ZBTB7A)

[Back to BioLiP]