Structure of PDB 7mt2 Chain F

Receptor sequence

>7mt2F (length=178) Species: 83332 (Mycobacterium tuberculosis H37Rv)

QPRLKERYRSEIRDALRKQFGYGNVMQIPTVTKVVVNMGVGEAARDAKLI
NGAVNDLALITGQKPEVRRARKSIAQFKLREGMPVGVRVTLRGDRMWEFL
DRLTSIALPRIRDFRGLSPKQFDGVGNYTFGLAEQAVFHEVDVDKIDRVR
GMDINVVTSAATDDEGRALLRALGFPFK

3D structure

• PDB: 7mt2 Interplay between an ATP-binding cassette F protein and the ribosome from Mycobacterium tuberculosis.
• Chain: F
• Resolution: 2.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	F	K40 V42 N44 G46 G48 R75 R78 Q83 F84 L86 V92 R95 Q128 D130 N134 T136 L139 G158 D160 N162	K33 V35 N37 G39 G41 R68 R71 Q76 F77 L79 V85 R88 Q121 D123 N127 T129 L132 G151 D153 N155
BS02	rna	F	N31 M33 K71 E73 V74 R95 V96 T97 R99 R102	N24 M26 K64 E66 V67 R88 V89 T90 R92 R95
BS03	rna	F	S80 A82 R87	S73 A75 R80

Gene Ontology

Molecular Function

• GO:0000049 tRNA binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0006412 translation

Cellular Component

• GO:0005840 ribosome
• GO:0005886 plasma membrane
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7mt2, PDBe:7mt2, PDBj:7mt2
• PDBsum: 7mt2
• PubMed: 35064151
• UniProt: P9WH83|RL5_MYCTU Large ribosomal subunit protein uL5 (Gene Name=rplE)